If you have been reading about residual moisture and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Storage stability depends on water content, oxygen exposure, and temperature. Lyophilized solids are hygroscopic and can absorb water if exposed to humid air. Vials are usually sealed under vacuum or inert gas with rubber stoppers and aluminum crimps. Storage temperatures range from room temperature to refrigerated or frozen conditions depending on the material. Stability studies track potency, moisture, and physical form over time. Accelerated conditions can reveal sensitivity but may not predict long-term behavior.
Analytical methods for lyophilized materials include X-ray diffraction for crystallinity, differential scanning calorimetry for thermal transitions, and scanning electron microscopy for pore morphology. Moisture sorption analysis shows how the cake responds to humidity. These methods help distinguish amorphous from crystalline states and detect phase changes. Open questions remain about how pore structure changes during long-term storage and how best to predict collapse under varied conditions. Comparisons across studies are complicated by differences in formulation, cycle, and storage history.
Quality control for lyophilized products focuses on appearance, moisture level, reconstitution time, and structural integrity. A cake should be uniform, intact, and free of meltback or collapse. Moisture level is measured by Karl Fischer titration or thermogravimetric analysis. Reconstitution time reflects pore structure and formulation. Visual inspection and vial integrity checks detect cracks, stopper defects, or particulate matter. These checks are often performed on samples from each batch. They help confirm that the drying cycle performed as intended.
Regulatory expectations for lyophilized products focus on consistent manufacture and documented stability. Batches are often monitored for moisture, appearance, potency, and sterility where applicable. Process parameters such as shelf temperature, chamber pressure, and drying time are recorded and controlled within validated ranges. Open questions remain about how best to predict long-term stability from short accelerated studies, especially for complex biologics. Variations in freezing rate and ice crystal size can produce differences that are not always visible but may affect performance.
After drying, a lyophilized product is usually sealed under vacuum or an inert gas to limit moisture uptake. Residual water content is measured because small changes can alter chemical stability and cake appearance. Storage temperature depends on the material; many biological products are kept at 2–8 °C, while some require −20 °C or colder. Exposure to ambient humidity during handling can cause the porous solid to absorb water and collapse. Container closures and stoppers are therefore selected for low moisture transmission and compatibility.
Quality control for lyophilized materials includes visual inspection of the cake, measurement of residual moisture, and tests for reconstitution time. An acceptable cake is typically uniform and may be slightly porous; shrinkage, meltback, or cracks can indicate process deviations. Analytical methods such as Karl Fischer titration, thermogravimetric analysis, and near-infrared spectroscopy quantify water content. Reconstitution time is recorded because a very slow or incomplete dissolution can signal collapse or aggregation. Stability studies compare samples stored under defined temperature and humidity conditions over months or years.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white porous cake | Color and texture vary with formulation. |
| Reconstitution time | Seconds to several minutes | Depends on cake porosity, excipients, and diluent. |
| Typical moisture level | 0.5-3% w/w | Lower values suit hydrolysis-sensitive materials. |
| Common moisture method | Karl Fischer titration | Coulometric mode is common for low water levels. |
| Typical storage temperature | 2-8 °C or ambient | Some products require frozen storage; protect from humidity. |
Handling practices aim to prevent moisture ingress and mechanical damage. Vials should remain stoppered and crimped until use, and reconstitution should follow the labeled diluent and volume. Shipping may involve temperature-controlled containers and desiccants, but direct contact between desiccant and product is avoided. Regulatory guidance expects documented storage conditions, excursion assessments, and stability commitments. Open questions remain about how best to predict long-term stability from short accelerated studies for every formulation class.
After lyophilization, the product is usually a porous cake or powder with a large internal surface area. This structure can absorb moisture quickly if exposed to humid air, so vials are sealed under vacuum or an inert gas. Moisture uptake may lower the glass transition temperature of the dried matrix and accelerate chemical or physical degradation. Storage conditions therefore depend on the formulation, container, and intended shelf life. Some products remain stable at room temperature, while others require refrigeration or freezing.
Misconceptions about lyophilization include the idea that dried products are indefinitely stable or that vacuum sealing eliminates all degradation. Chemical reactions can continue in the solid state, and some proteins lose activity even at low moisture. Another misconception is that any freeze-dryer cycle can be scaled by time alone; heat and mass transfer differ with equipment and load. Open questions remain about predicting long-term stability from short accelerated studies, particularly for amorphous formulations. Real-time stability data remain the standard for shelf-life assignment.
After lyophilization, the dried product is often sealed under vacuum or an inert gas to limit moisture and oxygen exposure. Vials, stoppers, and seals must maintain their barrier throughout shelf life. Storage temperature depends on product sensitivity: some cakes tolerate controlled room temperature, while labile biologics require refrigeration. Humidity is a critical variable because dried cakes are hygroscopic and can absorb water when exposed to air. Handling procedures therefore limit open-vial time and use desiccated environments for sampling.
Quality control for lyophilized materials examines appearance, reconstitution time, residual moisture, and mechanical integrity. An acceptable cake is usually uniform and porous, though appearance alone does not prove stability. Karl Fischer titration is a common method for water content, while differential scanning calorimetry can reveal glass transition events. Stability studies track potency, aggregation, and moisture over time under defined temperature and humidity conditions. Specifications are product-specific and may include sterility and endotoxin tests for sterile preparations.
Handling and storage practices aim to keep the cake intact and dry. Vials are typically stored upright at controlled temperatures, often between 2 °C and 8 °C or at -20 °C for longer-term use. Reconstitution involves adding a suitable diluent and gently mixing until the solid dissolves. Shaking or rapid injection of diluent can create foam or damage sensitive molecules. Once reconstituted, the product may require refrigeration and use within a defined period.
Residual moisture is a key quality attribute for lyophilized products. Water that remains after secondary drying can affect chemical stability, cake structure, and shelf life. Karl Fischer titration is a common method for measuring water content in the dried solid. The target range varies by product, but many biologics are dried to between 0.5% and 3% water by weight. Acceptable limits are set during development and confirmed by stability studies.
Stability studies examine how temperature, humidity, and time influence a lyophilized product. Accelerated conditions provide early information about degradation pathways, while long-term studies support shelf-life claims. The glass transition temperature of the dried formulation can indicate its physical stability, and storage above this temperature may increase molecular mobility and lead to collapse or aggregation. Container closure integrity also matters because moisture or oxygen ingress can degrade the product, so vial stoppers and seals are part of the quality system.
=== Collagen fibers === Type I collagen comprises approximately 85-95% of the organic matrix, providing the structural scaffold and tensile strength necessary for bone formation. These collagen fibers form a dense, highly cross-linked network that serves as the foundation for subsequent mineralization. The collagen molecules are arranged in layers that alternate parallel and orthogonal to the axis of stress loading, creating a sophisticated composite structure.
==== Other procedures ==== Orthokeratology is a method using specialized hard or rigid gas-permeable contact lenses to transiently reshape the cornea in order to improve the refractive state of the eye or reduce the need for eyeglasses and contact lenses. In 2009, researchers at the University of Pittsburgh Medical center demonstrated that stem cell collected from human corneas can restore transparency without provoking a rejection response in mice with corneal damage. For corneal epithelial diseases such as Stevens Johnson Syndrome, persistent corneal ulcer etc., the autologous contralateral (normal) suprabasal limbus derived in vitro expanded corneal limbal stem cells are found to be effective as amniotic membrane based expansion is controversial. For endothelial diseases, such as bullous keratopathy, cadaver corneal endothelial precursor cells have been proven to be efficient. Recently emerging tissue engineering technologies are expected to be capable of making one cadaver-donor's corneal cells be expanded and be usable in more than one patient's eye. One such technique has been reported to be safe and efficacious in a clinical pilot study with long term follow-up.
Rubidium has also been considered for use in a thermoelectric generator using the magnetohydrodynamic principle, whereby hot rubidium ions are passed through a magnetic field. These conduct electricity and act like an armature of a generator, thereby generating an electric current. Rubidium, particularly vaporized 87Rb, is one of the most commonly used atomic species employed for laser cooling and Bose–Einstein condensation. Its desirable features for this application include the ready availability of inexpensive diode laser light at the relevant wavelength and the moderate temperatures required to obtain substantial vapor pressures. For cold-atom applications requiring tunable interactions, 85Rb is preferred for its rich Feshbach spectrum. Rubidium has been used for polarizing 3He, producing volumes of magnetized 3He gas, with the nuclear spins aligned rather than random. Rubidium vapor is optically pumped by a laser, and the polarized Rb polarizes 3He through the hyperfine interaction. Such spin-polarized 3He cells are useful for neutron polarization measurements and for producing polarized neutron beams for other purposes. The resonant element in atomic clocks utilizes the hyperfine structure of rubidium's energy levels, and rubidium is useful for high-precision timing. It is used as the main component of secondary frequency references (rubidium oscillators) in cell site transmitters and other electronic transmitting, networking, and test equipment.
=== Freezing and annealing === During the freezing stage, the material is cooled below its triple point, the temperature at which the solid, liquid, and gas phases of the material can coexist. This ensures that sublimation rather than melting will occur in the following steps. To facilitate faster and more efficient freeze drying, larger ice crystals are preferable. The large ice crystals form a network within the product which promotes faster removal of water vapor during sublimation. To produce larger crystals, the product should be frozen slowly or can be cycled up and down in temperature in a process called annealing. The freezing phase is the most critical in the whole freeze-drying process, as the freezing method can impact the speed of reconstitution, duration of freeze-drying cycle, product stability, and appropriate crystallization. Amorphous materials do not have a eutectic point, but they do have a critical point, below which the product must be maintained to prevent melt-back or collapse during primary and secondary drying.
=== Child soldiers and human shields === Houthis have been accused of violations of international humanitarian law, such as using child soldiers, shelling civilian areas, forced evacuations and executions. According to Human Rights Watch, Houthis intensified their recruitment of children in 2015. UNICEF mentioned that children with the Houthis and other armed groups in Yemen comprise up to a third of all fighters in Yemen. Human Rights Watch has further accused Houthi forces of using landmines in Yemen's third-largest city of Taizz, which has caused many civilian casualties and prevented the return of families displaced by the fighting. HRW has also accused the Houthis of interfering with the work of Yemen's human rights advocates and organizations. In 2009, HRW researcher Christoph Wilcke said that although the Republic of Yemen Government accused the Houthis of using civilians as human shields, HRW did not have enough evidence to conclude that the Houthis were intentionally doing so. Nonetheless, Wilcke stated that there may have been cases in which HRW was unable to document. Akram Al Walidi, one of four journalists detained by the Houthis on spying charges and then released in April 2023 as part of a prisoner exchange deal between the former and the internationally recognized government of Yemen, said he felt like the four were human shields after the Houthis moved them to one of their military camps at Sanaa in October 2020 since it was an expected target of Saudi airstrikes.
Sources: en.wikipedia.org
== First generation GcMAF == Gc protein-derived macrophage-activating factor (GcMAF). GcMAF initially conceptualized by Nobuto Yamamoto in 1991, has been researched as a possible cancer treatment. Previous research efforts involved the isolation of Gc protein (1f1f subtype) from human serum through an affinity column modified with 25-hydroxyvitamin D3. GcMAF was enzymatically derived from the isolated Gc protein.
BioDuro is an American contract research, development, and manufacturing organization (CRDMO) headquartered in Irvine, California. Founded in 1996, the company operates seven R&D and manufacturing campuses across the United States and China and employs more than 2,000 scientists worldwide. BioDuro provides integrated services from discovery through commercial manufacturing, including medicinal chemistry, biology, drug metabolism and pharmacokinetics (DMPK), drug substance, and drug product development. Its capabilities extend across modalities such as small molecules, peptides, oligonucleotides, and antibody–drug conjugates (ADCs).
Her voice chilled. "Now I'm sick of you. Sick of you." She took a wineglass from the table, went to the bureau, and poured paregoric until the glass was half full. "Here, Mother, drink it. It will be good for you." John Steinbeck, East of Eden
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Glucose + 2 NAD+ + 2 ADP + 2 Pi → 2 Pyruvate + 2 NADH + 2 H+ + 2 ATP + 2 H2O If glycolysis were to continue indefinitely, all of the NAD+ would be used up, and glycolysis would stop. To allow glycolysis to continue, organisms must be able to oxidize NADH back to NAD+. How this is performed depends on which external electron acceptor is available.
Sources: en.wikipedia.org
Karl Fischer titration is a common method, using coulometric or volumetric detection. Thermogravimetric analysis can also measure weight loss on heating. Results depend on sample handling because the dried solid can absorb moisture quickly.
The porous cake readily absorbs water vapor from air, which can reduce stability or cause collapse. Vials are sealed with stoppers and crimp seals, sometimes under vacuum or inert gas. Packaging also protects against oxygen and mechanical damage.
Collapse occurs when the product temperature rises above its collapse threshold during primary drying. The ice matrix loses structure, and the cake may shrink or melt back. Formulation excipients and freezing rate influence collapse threshold.
Most are held in sealed containers at controlled temperatures, often 2–8 °C, while some require frozen storage. Protection from moisture and light helps preserve the dry matrix. Exact conditions are set by the manufacturer or study protocol.